Structure of the stub1 tpr domain in complex with h201, an all-d helicon polypeptide
PDB DOI: 10.2210/pdb8f14/pdb
Classification: LIGASE Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2022-11-04 Deposition Author(s): Callahan, A.J. , Li, K. , Mcgee, J.H. , Pentelute, B.L. , Swiecicki, J.-M. , Tokareva, O.S. , Travaline, T.L. , Verdine, G.L.
Structure of the stub1 tpr domain in complex with h201, an all-d helicon polypeptide
Callahan, A.J. , Li, K. , Mcgee, J.H. , Pentelute, B.L. , Swiecicki, J.-M. , Tokareva, O.S. , Travaline, T.L. , Verdine, G.L.
Primary Citation of Related Structures: 8F14
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
E3 ubiquitin-protein ligase CHIP | A | 134 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GASPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERR |
all-D Helicon Polypeptide H201 | B | 17 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XPWEDCAWFAWACYNIX |
Method: X-RAY DIFFRACTION
Deposited Date: 2022-11-04 Deposition Author(s): Callahan, A.J. , Li, K. , Mcgee, J.H. , Pentelute, B.L. , Swiecicki, J.-M. , Tokareva, O.S. , Travaline, T.L. , Verdine, G.L.