Structure of the mdm2 p53 binding domain in complex with h103, an all-d helicon polypeptide, alternative c-terminus
PDB DOI: 10.2210/pdb8f13/pdb
Classification: LIGASE Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2022-11-04 Deposition Author(s): Callahan, A.J. , Li, K. , Mcgee, J.H. , Pentelute, B.L. , Swiecicki, J.-M. , Tokareva, O.S. , Travaline, T.L. , Verdine, G.L.
Structure of the mdm2 p53 binding domain in complex with h103, an all-d helicon polypeptide, alternative c-terminus
Callahan, A.J. , Li, K. , Mcgee, J.H. , Pentelute, B.L. , Swiecicki, J.-M. , Tokareva, O.S. , Travaline, T.L. , Verdine, G.L.
Primary Citation of Related Structures: 8F13
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
E3 ubiquitin-protein ligase Mdm2 | A | 95 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVN |
H103 | B | 19 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XDPAWYECLEAALLCQQVX |
Method: X-RAY DIFFRACTION
Deposited Date: 2022-11-04 Deposition Author(s): Callahan, A.J. , Li, K. , Mcgee, J.H. , Pentelute, B.L. , Swiecicki, J.-M. , Tokareva, O.S. , Travaline, T.L. , Verdine, G.L.