Contact-dependent growth inhibition (cdi) immunity protein from e. coli o32:h37
PDB DOI: 10.2210/pdb8ey3/pdb
Classification: TOXIN Organism(s): Streptococcus Pneumoniae Serotype 4
Deposited: 2022-10-26 Deposition Author(s): Center For Structural Genomics Of Infectious Diseases (Csgid) , Eschenfeldt, W. , Goulding, C.W. , Hayes, C.S. , Joachimiak, A. , Michalska, K. , Midwest Center For Structural Genomics (Mcsg) , Stols, L.
Contact-dependent growth inhibition (cdi) immunity protein from e. coli o32:h37
Center For Structural Genomics Of Infectious Diseases (Csgid) , Eschenfeldt, W. , Goulding, C.W. , Hayes, C.S. , Joachimiak, A. , Michalska, K. , Midwest Center For Structural Genomics (Mcsg) , Stols, L.
Primary Citation of Related Structures: 8EY3
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Cys_rich_CPCC domain-containing protein | A | 65 | Streptococcus Pneumoniae Serotype 4 | SNAMMNNGSYPCPCCGNKTIDEPGCYEICPICGWEDDPVQSADPDFSGGANSPSLNEAKRAFNEQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2022-10-26 Deposition Author(s): Center For Structural Genomics Of Infectious Diseases (Csgid) , Eschenfeldt, W. , Goulding, C.W. , Hayes, C.S. , Joachimiak, A. , Michalska, K. , Midwest Center For Structural Genomics (Mcsg) , Stols, L.