8EI0
Crystal structure of the stub1 tpr domain in complex with h318, a helicon polypeptide
PDB DOI: 10.2210/pdb8ei0/pdb
Classification: LIGASE Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2022-09-14 Deposition Author(s): Li, K. , Mcgee, J.H. , Swiecicki, J.-M. , Thomson, T.M. , Tokareva, O.S. , Verdine, G.L.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.47 Å
Crystal structure of the stub1 tpr domain in complex with h318, a helicon polypeptide
Li, K. , Mcgee, J.H. , Swiecicki, J.-M. , Thomson, T.M. , Tokareva, O.S. , Verdine, G.L.
Primary Citation of Related Structures: 8EI0
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| E3 ubiquitin-protein ligase CHIP | A | 134 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GASPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERR |
| H318 | B | 13 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XPCYEAWVLCEYX |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2022-09-14 Deposition Author(s): Li, K. , Mcgee, J.H. , Swiecicki, J.-M. , Thomson, T.M. , Tokareva, O.S. , Verdine, G.L.