Nmr shows why a small chemical change almost abolishes the antimicrobial activity of gccf
PDB DOI: 10.2210/pdb8dfz/pdb
Classification: ANTIMICROBIAL PROTEIN Organism(s): Lactiplantibacillus Plantarum
Deposited: 2022-06-23 Deposition Author(s): Edwards, P.J.B. , Harjes, E. , Norris, G.
Method: SOLUTION NMR Resolution: N.A.
Nmr shows why a small chemical change almost abolishes the antimicrobial activity of gccf
Edwards, P.J.B. , Harjes, E. , Norris, G.
Primary Citation of Related Structures: 8DFZ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Bacteriocin glycocin F | A | 43 | Lactiplantibacillus Plantarum | KPAWCWYTLAMCGAGYDSGTCDYMYSHCFGIKHHSSGSSSYHC |
Method: SOLUTION NMR
Deposited Date: 2022-06-23 Deposition Author(s): Edwards, P.J.B. , Harjes, E. , Norris, G.