Parathyroid hormone 1 receptor extracellular domain complexed with a peptide ligand containing (2-naphthyl)-beta-3-homoalanine
PDB DOI: 10.2210/pdb8d52/pdb
Classification: SIGNALING PROTEIN Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2022-06-03 Deposition Author(s): Gellman, S.H. , Kreitler, D.F. , Yu, Z.
Method: X-RAY DIFFRACTION Resolution: 2.02 Å
Parathyroid hormone 1 receptor extracellular domain complexed with a peptide ligand containing (2-naphthyl)-beta-3-homoalanine
Gellman, S.H. , Kreitler, D.F. , Yu, Z.
Primary Citation of Related Structures: 8D52
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Parathyroid hormone/parathyroid hormone-related peptide receptor | A | 103 | Homo Sapiens , Synthetic Construct | GDDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPAGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFL |
| PTHrP[1-36] | B | 22 | Homo Sapiens , Synthetic Construct | IQDLRRRFFLHHLIAEXHTAEI |
Method: X-RAY DIFFRACTION
Deposited Date: 2022-06-03 Deposition Author(s): Gellman, S.H. , Kreitler, D.F. , Yu, Z.