Sh3 domain solved by the exact solid-state method from the bruker dynamics center using the combined correction method with pdb 2nuz
PDB DOI: 10.2210/pdb8cf4/pdb
Classification: PEPTIDE BINDING PROTEIN Organism(s): Gallus Gallus
Deposited: 2023-02-02 Deposition Author(s): Soeldner, B.
Sh3 domain solved by the exact solid-state method from the bruker dynamics center using the combined correction method with pdb 2nuz
Primary Citation of Related Structures: 8CF4
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Spectrin alpha chain, non-erythrocytic 1 | A | 62 | Gallus Gallus | MDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD |
Method: SOLID-STATE NMR
Deposited Date: 2023-02-02 Deposition Author(s): Soeldner, B.