Spatial structure of lch-alpha peptide from two-component lantibiotic system lichenicidin vk21
PDB DOI: 10.2210/pdb8c5j/pdb
Classification: ANTIBIOTIC Organism(s): Bacillus Licheniformis
Deposited: 2023-01-09 Deposition Author(s): Arseniev, A.S. , Mineev, K.S. , Ovchinnikova, T.V. , Paramonov, A.S. , Shenkarev, Z.O.
Spatial structure of lch-alpha peptide from two-component lantibiotic system lichenicidin vk21
Arseniev, A.S. , Mineev, K.S. , Ovchinnikova, T.V. , Paramonov, A.S. , Shenkarev, Z.O.
Primary Citation of Related Structures: 8C5J
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Lantibiotic lichenicidin VK21 A1 | A | 32 | Bacillus Licheniformis | XIALSTCAILAKPLGNNGYLCAVAKECMPSCN |
Method: SOLUTION NMR
Deposited Date: 2023-01-09 Deposition Author(s): Arseniev, A.S. , Mineev, K.S. , Ovchinnikova, T.V. , Paramonov, A.S. , Shenkarev, Z.O.