Molecular structure of cu(ii)-bound amyloid-beta monomer implicated in inhibition of peptide self-assembly in alzheimer's disease
PDB DOI: 10.2210/pdb8b9r/pdb
Classification: METAL BINDING PROTEIN Organism(s): Homo Sapiens
Deposited: 2022-10-06 Deposition Author(s): Abelein, A. , Biverstal, H. , Ciofi-Baffoni, S. , Giachetti, A. , Kumar, R. , Morman, C. , Piccioli, M.
Molecular structure of cu(ii)-bound amyloid-beta monomer implicated in inhibition of peptide self-assembly in alzheimer's disease
Abelein, A. , Biverstal, H. , Ciofi-Baffoni, S. , Giachetti, A. , Kumar, R. , Morman, C. , Piccioli, M.
Primary Citation of Related Structures: 8B9R
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Amyloid-beta A4 protein | A | 40 | Homo Sapiens | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
Method: SOLUTION NMR
Deposited Date: 2022-10-06 Deposition Author(s): Abelein, A. , Biverstal, H. , Ciofi-Baffoni, S. , Giachetti, A. , Kumar, R. , Morman, C. , Piccioli, M.