Crystal structure of shank2-sam domain
PDB DOI: 10.2210/pdb8atj/pdb
Classification: METAL BINDING PROTEIN Organism(s): Homo Sapiens
Deposited: 2022-08-23 Deposition Author(s): Bento, I. , Gracia Alai, M. , Kreienkamp, J.-H.
Method: X-RAY DIFFRACTION Resolution: 2.117 Å
Crystal structure of shank2-sam domain
Bento, I. , Gracia Alai, M. , Kreienkamp, J.-H.
Primary Citation of Related Structures: 8ATJ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Isoform 4 of SH3 and multiple ankyrin repeat domains protein 2 | AAA | 70 | Homo Sapiens | TKPVHLWTKPDVADWLESLNLGEHKEAFMDNEIDGSHLPNLQKEDLIDLGVTRVGHRMNIERALKQLLDR |
Method: X-RAY DIFFRACTION
Deposited Date: 2022-08-23 Deposition Author(s): Bento, I. , Gracia Alai, M. , Kreienkamp, J.-H.