Crystal structure of anthocyanin-related gstf8 from populus trichocarpa in complex with (-)-catechin and glutathione
PDB DOI: 10.2210/pdb8agq/pdb
Classification: TRANSFERASE Organism(s): Populus Trichocarpa
Deposited: 2022-07-20 Deposition Author(s): Buller, M.R. , Eichenberger, M. , Hueppi, S. , Mittl, P. , Schwander, T.
Method: X-RAY DIFFRACTION Resolution: 1.093 Å
Crystal structure of anthocyanin-related gstf8 from populus trichocarpa in complex with (-)-catechin and glutathione
Buller, M.R. , Eichenberger, M. , Hueppi, S. , Mittl, P. , Schwander, T.
Primary Citation of Related Structures: 8AGQ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Glutathione transferase | A | 214 | Populus Trichocarpa | MVVKVYGPAVAVCPQRVMACLLEKGVEFDLVHVDLDSGEQKLPEFLLKQPFGQVPVVEDGDFKLFESRAIIRYYAAKYEDRGPNLLGNTLEEKALVDQWLEIEAHNFNDLVFNIVFQVVILPRIGQQGDSELVRTYEEKLEKVLDVYEKRLSKSKYLAGDSFTLADLSHLPATRYLVNEAGLGHLVKDRKKLNAWWEDISSRPAWKKLMNLAGF |
Method: X-RAY DIFFRACTION
Deposited Date: 2022-07-20 Deposition Author(s): Buller, M.R. , Eichenberger, M. , Hueppi, S. , Mittl, P. , Schwander, T.