Crystal structure of unlinked ns2b-ns3 protease from zika virus in complex with inhibitor mi-2195
PDB DOI: 10.2210/pdb7zv4/pdb
Classification: VIRAL PROTEIN Organism(s): Zika Virus
Deposited: 2022-05-13 Deposition Author(s): Huber, S. , Steinmetzer, T.
Crystal structure of unlinked ns2b-ns3 protease from zika virus in complex with inhibitor mi-2195
Primary Citation of Related Structures: 7ZV4
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Serine protease subunit NS2B | A | 53 | Zika Virus | MTGKSVDMYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEEDGPPMRE |
| Serine protease NS3 | B | 178 | Zika Virus | GSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGAALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGLSEVQLLAVPPGERAKNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGKREEETPVE |
Method: X-RAY DIFFRACTION
Deposited Date: 2022-05-13 Deposition Author(s): Huber, S. , Steinmetzer, T.