Human gabarap in complex with stapled peptide pen8-ortho
PDB DOI: 10.2210/pdb7zl7/pdb
Classification: PROTEIN BINDING Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2022-04-14 Deposition Author(s): Brown, H. , Kritzer, J.A. , Ueffing, A. , Weiergraeber, O.H. , Willbold, D.
Human gabarap in complex with stapled peptide pen8-ortho
Brown, H. , Kritzer, J.A. , Ueffing, A. , Weiergraeber, O.H. , Willbold, D.
Primary Citation of Related Structures: 7ZL7
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Gamma-aminobutyric acid receptor-associated protein | A | 119 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSMKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL |
Gamma-aminobutyric acid receptor-associated protein | C | 119 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSMKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL |
Pen8-ortho | D | 14 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XDACYTWEXLAWPX |
Pen8-ortho | B | 14 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XDACYTWEXLAWPX |
Method: X-RAY DIFFRACTION
Deposited Date: 2022-04-14 Deposition Author(s): Brown, H. , Kritzer, J.A. , Ueffing, A. , Weiergraeber, O.H. , Willbold, D.