Transcription factor myf5 bound to non-symmetrical site
PDB DOI: 10.2210/pdb7z5k/pdb
Classification: TRANSCRIPTION Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2022-03-09 Deposition Author(s): Morgunova, E. , Popov, A. , Taipale, J. , Yin, Y.
Transcription factor myf5 bound to non-symmetrical site
Morgunova, E. , Popov, A. , Taipale, J. , Yin, Y.
Primary Citation of Related Structures: 7Z5K
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Myogenic factor 5 | A | 57 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SMDRRKAATMRERRRLKKVNQAFETLKRCTTTNPNQRLPKVEILRNAIRYIESLQEL |
Myogenic factor 5 | B | 57 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SMDRRKAATMRERRRLKKVNQAFETLKRCTTTNPNQRLPKVEILRNAIRYIESLQEL |
Method: X-RAY DIFFRACTION
Deposited Date: 2022-03-09 Deposition Author(s): Morgunova, E. , Popov, A. , Taipale, J. , Yin, Y.