Crystal structure of the zebrafish foxh1 bound to the tgtttact site (fkh motif gtaaaca)
PDB DOI: 10.2210/pdb7yzd/pdb
Classification: DNA BINDING PROTEIN Organism(s): Danio Rerio , Synthetic Construct
Deposited: 2022-02-19 Deposition Author(s): Macias, M.J. , Pluta, R.
Crystal structure of the zebrafish foxh1 bound to the tgtttact site (fkh motif gtaaaca)
Primary Citation of Related Structures: 7YZD
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Forkhead box protein H1 | A | 125 | Danio Rerio , Synthetic Construct | GGKKKNYQRYPKPPYSYLAMIAMVIQNSPEKKLTLSEILKEISTLFPFFKGNYKGWRDSVRHNLSSYDCFVKVLKDPGKPQGKGNFWTVEVNRIPLELLKRQNTAVSRQDETIFAQDLAPYIFQG |
Method: X-RAY DIFFRACTION
Deposited Date: 2022-02-19 Deposition Author(s): Macias, M.J. , Pluta, R.