Fungal immunomodulatory protein fip-gmi
PDB DOI: 10.2210/pdb7wdm/pdb
Classification: IMMUNE SYSTEM Organism(s): Ganoderma Microsporum
Deposited: 2021-12-22 Deposition Author(s): Bastiaan-Net, S. , Du, G. , Hoppenbrouwers, T. , Imam, K.M.S.U. , Li, Z. , Liu, Y. , Wang, Y. , Wei, X. , Wichers, H.J. , Xie, Y. , Zhang, H. , Zhang, Y.
Fungal immunomodulatory protein fip-gmi
Bastiaan-Net, S. , Du, G. , Hoppenbrouwers, T. , Imam, K.M.S.U. , Li, Z. , Liu, Y. , Wang, Y. , Wei, X. , Wichers, H.J. , Xie, Y. , Zhang, H. , Zhang, Y.
Primary Citation of Related Structures: 7WDM
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Immunomodulatory protein | A | 133 | Ganoderma Microsporum | GPLGSMSDTALIFTLAWNVKQLAFDYTPNWGRGRPSSFIDTVTFPTVLTDKAYTYRVVVSGKDLGVRPSYAVESDGSQKINFLEYNSGYGIADTNTIQVYVIDPDTGNNFIVAQWNYLEQKLISEEDLNSAVD |
Method: X-RAY DIFFRACTION
Deposited Date: 2021-12-22 Deposition Author(s): Bastiaan-Net, S. , Du, G. , Hoppenbrouwers, T. , Imam, K.M.S.U. , Li, Z. , Liu, Y. , Wang, Y. , Wei, X. , Wichers, H.J. , Xie, Y. , Zhang, H. , Zhang, Y.