Crystal structure of hiv-1 integrase catalytic core domain in complex with (2s)-2-(tert-butoxy)-2-(10-fluoro-2-(2-hydroxy-4-methylphenyl)-1,4-dimethyl-5-(methylsulfonyl)-5,6-dihydrophenanthridin-3-yl)acetic acid
PDB DOI: 10.2210/pdb7wce/pdb
Classification: HYDROLASE Organism(s): Human Immunodeficiency Virus Type 1 (New York-5 Isolate)
Deposited: 2021-12-20 Deposition Author(s): Sekiguchi, Y. , Taoda, Y.
Crystal structure of hiv-1 integrase catalytic core domain in complex with (2s)-2-(tert-butoxy)-2-(10-fluoro-2-(2-hydroxy-4-methylphenyl)-1,4-dimethyl-5-(methylsulfonyl)-5,6-dihydrophenanthridin-3-yl)acetic acid
Primary Citation of Related Structures: 7WCE
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Integrase catalytic | A | 166 | Human Immunodeficiency Virus Type 1 (New York-5 Isolate) | GSHMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDIQTKE |
Method: X-RAY DIFFRACTION
Deposited Date: 2021-12-20 Deposition Author(s): Sekiguchi, Y. , Taoda, Y.