Nmr solution structure of the de novo designed small beta-barrel protein 33_bp_sh3
PDB DOI: 10.2210/pdb7uwz/pdb
Classification: DE NOVO PROTEIN Organism(s): Fremyella Diplosiphon
Deposited: 2022-05-04 Deposition Author(s): Baker, D. , Chow, C.M. , Jensen, D.R. , Kim, D.E. , Peterson, F.C. , Saleem, A. , Volkman, B.F.
Nmr solution structure of the de novo designed small beta-barrel protein 33_bp_sh3
Baker, D. , Chow, C.M. , Jensen, D.R. , Kim, D.E. , Peterson, F.C. , Saleem, A. , Volkman, B.F.
Primary Citation of Related Structures: 7UWZ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
De novo designed small beta-barrel protein 33_bp_sh3 | A | 62 | Fremyella Diplosiphon | MDGFDRGADVTYTDSDGSKKTYKVLSYSGDKVTVQDSDGRTLTFDARLLRVKKWLEHHHHHH |
Method: SOLUTION NMR
Deposited Date: 2022-05-04 Deposition Author(s): Baker, D. , Chow, C.M. , Jensen, D.R. , Kim, D.E. , Peterson, F.C. , Saleem, A. , Volkman, B.F.