Crystal structure of the first bromodomain of human brdt in complex with the inhibitor ccd-956
PDB DOI: 10.2210/pdb7ubo/pdb
Classification: TRANSCRIPTION/INHIBITOR Organism(s): Homo Sapiens
Deposited: 2022-03-15 Deposition Author(s): Kim, C. , Matzuk, M.M. , Modukuri, R.K. , Ta, H.M. , Tan, Z. , Yu, Z.
Crystal structure of the first bromodomain of human brdt in complex with the inhibitor ccd-956
Kim, C. , Matzuk, M.M. , Modukuri, R.K. , Ta, H.M. , Tan, Z. , Yu, Z.
Primary Citation of Related Structures: 7UBO
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Bromodomain testis-specific protein | A | 110 | Homo Sapiens | LTNQLQYLQKVVLKDLWKHSFSWPFQRPVDAVKLQLPDYYTIIKNPMDLNTIKKRLENKYYAKASECIEDFNTMFSNCYLYNKPGDDIVLMAQALEKLFMQKLSQMPQEE |
| Bromodomain testis-specific protein | B | 110 | Homo Sapiens | LTNQLQYLQKVVLKDLWKHSFSWPFQRPVDAVKLQLPDYYTIIKNPMDLNTIKKRLENKYYAKASECIEDFNTMFSNCYLYNKPGDDIVLMAQALEKLFMQKLSQMPQEE |
| Bromodomain testis-specific protein | C | 110 | Homo Sapiens | LTNQLQYLQKVVLKDLWKHSFSWPFQRPVDAVKLQLPDYYTIIKNPMDLNTIKKRLENKYYAKASECIEDFNTMFSNCYLYNKPGDDIVLMAQALEKLFMQKLSQMPQEE |
| Bromodomain testis-specific protein | D | 110 | Homo Sapiens | LTNQLQYLQKVVLKDLWKHSFSWPFQRPVDAVKLQLPDYYTIIKNPMDLNTIKKRLENKYYAKASECIEDFNTMFSNCYLYNKPGDDIVLMAQALEKLFMQKLSQMPQEE |
Method: X-RAY DIFFRACTION
Deposited Date: 2022-03-15 Deposition Author(s): Kim, C. , Matzuk, M.M. , Modukuri, R.K. , Ta, H.M. , Tan, Z. , Yu, Z.