Hic2 zinc finger domain in complex with the dna binding motif-2 of the bcl11a enhancer
PDB DOI: 10.2210/pdb7txc/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2022-02-08 Deposition Author(s): Cheng, X. , Horton, J.R. , Ren, R.
Hic2 zinc finger domain in complex with the dna binding motif-2 of the bcl11a enhancer
Cheng, X. , Horton, J.R. , Ren, R.
Primary Citation of Related Structures: 7TXC
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Hypermethylated in cancer 2 protein | E | 118 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPLGSRPFKCSVCEKTYKDPATLRQHEKTHWLTRPFPCNICGKMFTQRGTMTRHMRSHLGLKPFACDECGMRFTRQYRLTEHMRVHSGEKPYECQLCGGKFTQQRNLISHLRMHTSPS |
Method: X-RAY DIFFRACTION
Deposited Date: 2022-02-08 Deposition Author(s): Cheng, X. , Horton, J.R. , Ren, R.