Structure of e. coli ms115-1 caph n-terminal domain
PDB DOI: 10.2210/pdb7t5u/pdb
Classification: DNA BINDING PROTEIN Organism(s): Escherichia Coli
Deposited: 2021-12-13 Deposition Author(s): Corbett, K.D. , Lau, R.K.
Structure of e. coli ms115-1 caph n-terminal domain
Primary Citation of Related Structures: 7T5U
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Helix-turn-helix domain-containing protein | A | 69 | Escherichia Coli | SNAATRLGEKLRDLRKQRGLTLEKLADMAGLSKSYLWELENRESQRPSAEKLTALADALGVGTSFFLED |
Method: X-RAY DIFFRACTION
Deposited Date: 2021-12-13 Deposition Author(s): Corbett, K.D. , Lau, R.K.