Solution structure of spider toxin ssp1a
PDB DOI: 10.2210/pdb7skc/pdb
Classification: TOXIN Organism(s): Selenotypus
Deposited: 2021-10-20 Deposition Author(s): Daly, N.L. , Dongol, Y. , Lewis, R.J. , Wilson, D.T.
Solution structure of spider toxin ssp1a
Daly, N.L. , Dongol, Y. , Lewis, R.J. , Wilson, D.T.
Primary Citation of Related Structures: 7SKC
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Ssp1a toxin | A | 34 | Selenotypus | GDCLGWFSGCDPNNNKCCEGYVCHWKYPWCRYDL |
Method: SOLUTION NMR
Deposited Date: 2021-10-20 Deposition Author(s): Daly, N.L. , Dongol, Y. , Lewis, R.J. , Wilson, D.T.