Structure of the ptp-like myo-inositol phosphatase from legionella pneumophila str. paris in complex with myo-inositol-(1,3,4,5)-tetrakisphosphate
PDB DOI: 10.2210/pdb7sdd/pdb
Classification: HYDROLASE Organism(s): Legionella Pneumophila Str. Paris
Deposited: 2021-09-29 Deposition Author(s): Cleland, C.P. , Mosimann, S.C.
Structure of the ptp-like myo-inositol phosphatase from legionella pneumophila str. paris in complex with myo-inositol-(1,3,4,5)-tetrakisphosphate
Cleland, C.P. , Mosimann, S.C.
Primary Citation of Related Structures: 7SDD
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Myo-inositol phosphohydrolase | A | 314 | Legionella Pneumophila Str. Paris | MKKNHHHHHHLVPRGSKLASSIVCDSTIENPCIVQDSKTQFSPVIRYREVASIADVYGGNITGINKFHLSGSEQPSEKGWEAIAESISRKMGAETKKVIVLDLRQESHGYLNGRAITLVSVYNWINLGKSNSQSTLDQENWLTGLRSRKIVNGVLTVPQYVAKQYSQGKSMVVSTVKNEEYYVYKKGFDYYRIFISDHRAPLDSEVDALVALIKNNPEDTWYHVHSRGGKGRTTTVFAMFDMLKNADKVSFEEIIARQASIPPFYNLMVTNREIPELTPYYEQRLQFLIHFYEFARQSLMGYSGTWSEWKKLNI |
Method: X-RAY DIFFRACTION
Deposited Date: 2021-09-29 Deposition Author(s): Cleland, C.P. , Mosimann, S.C.