Membrane bound structure of hr1 domain of sars-cov-2 spike protein
PDB DOI: 10.2210/pdb7r95/pdb
Classification: VIRAL PROTEIN Organism(s): Severe Acute Respiratory Syndrome Coronavirus 2
Deposited: 2021-06-28 Deposition Author(s): Bax, A. , Chiliveri, S.C.
Method: SOLUTION NMR Resolution: N.A.
Membrane bound structure of hr1 domain of sars-cov-2 spike protein
Primary Citation of Related Structures: 7R95
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Spike protein S2 | A | 56 | Severe Acute Respiratory Syndrome Coronavirus 2 | GSWNQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQSGLVPR |
Method: SOLUTION NMR
Deposited Date: 2021-06-28 Deposition Author(s): Bax, A. , Chiliveri, S.C.