Structural biology of the ns1 avian influenza protein subversion on the scribble cell polarity module
PDB DOI: 10.2210/pdb7qtp/pdb
Classification: VIRAL PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2022-01-15 Deposition Author(s): Humbert, P.O. , Javorsky, A. , Kvansakul, M.
Structural biology of the ns1 avian influenza protein subversion on the scribble cell polarity module
Humbert, P.O. , Javorsky, A. , Kvansakul, M.
Primary Citation of Related Structures: 7QTP
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Protein scribble homolog | A | 117 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SAPSVKGVSFDQANNLLIEPARIEEEELTLTILRQTGGLGISIAGGKGSTPYKGDDEGIFISRVSEEGPAARAGVRVGDKLLEVNGVALQGAEHHEAVEALRGAGTAVQMRVWRERM |
Non-structural protein 1 | B | 10 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | KMARTIESKV |
Method: X-RAY DIFFRACTION
Deposited Date: 2022-01-15 Deposition Author(s): Humbert, P.O. , Javorsky, A. , Kvansakul, M.