7QSA
Structural basis on the interaction of scribble pdz domains with the tick born encephalitis virus (tbev) ns5 protein
PDB DOI: 10.2210/pdb7qsa/pdb
Classification: VIRAL PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2022-01-13 Deposition Author(s): Humbert, P.O. , Javorsky, A. , Kvansakul, M.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.02 Å
Structural basis on the interaction of scribble pdz domains with the tick born encephalitis virus (tbev) ns5 protein
Humbert, P.O. , Javorsky, A. , Kvansakul, M.
Primary Citation of Related Structures: 7QSA
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protein scribble homolog | A | 92 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SVEEIRLPRAGGPLGLSIVGGSDHSSHPFGVQEPGVFISKVLPRGLAARSGLRVGDRILAVNGQDVRDATHQEAVSALLRPCLELSLLVRRD |
| Protein scribble homolog | B | 92 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SVEEIRLPRAGGPLGLSIVGGSDHSSHPFGVQEPGVFISKVLPRGLAARSGLRVGDRILAVNGQDVRDATHQEAVSALLRPCLELSLLVRRD |
| RNA-directed RNA polymerase NS5 | C | 8 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | LRLESSII |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2022-01-13 Deposition Author(s): Humbert, P.O. , Javorsky, A. , Kvansakul, M.