Crystal structure of the intertwined dimer of the c-src sh3 domain e93v-s94a-r95s-t96g-n112g-n113y-t114n-e115h mutant
PDB DOI: 10.2210/pdb7pvw/pdb
Classification: PROTEIN BINDING Organism(s): Gallus Gallus
Deposited: 2021-10-05 Deposition Author(s): Camara-Artigas, A. , Salinas Garcia, M.C.
Crystal structure of the intertwined dimer of the c-src sh3 domain e93v-s94a-r95s-t96g-n112g-n113y-t114n-e115h mutant
Camara-Artigas, A. , Salinas Garcia, M.C.
Primary Citation of Related Structures: 7PVW
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Isoform 1 of Proto-oncogene tyrosine-protein kinase Src | A | 60 | Gallus Gallus | GVTTFVALYDYVASGETDLSFKKGERLQIVGYNHGDWWLAHSLTTGQTGYIPSNYVAPSD |
Isoform 1 of Proto-oncogene tyrosine-protein kinase Src | B | 60 | Gallus Gallus | GVTTFVALYDYVASGETDLSFKKGERLQIVGYNHGDWWLAHSLTTGQTGYIPSNYVAPSD |
Method: X-RAY DIFFRACTION
Deposited Date: 2021-10-05 Deposition Author(s): Camara-Artigas, A. , Salinas Garcia, M.C.