7PLL
Structure of the murine cortactin c-sh3 domain in complex with a pyk2 proline-rich ligand
PDB DOI: 10.2210/pdb7pll/pdb
Classification: CELL INVASION Organism(s): Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2021-08-31 Deposition Author(s): Chill, J.H. , Gil-Henn, H. , Samson, A.O. , Sokolik, C.G.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Structure of the murine cortactin c-sh3 domain in complex with a pyk2 proline-rich ligand
Chill, J.H. , Gil-Henn, H. , Samson, A.O. , Sokolik, C.G.
Primary Citation of Related Structures: 7PLL
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Src substrate cortactin | A | 60 | Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GHMGITAIALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVELRQ |
| Pyk2-PRR2 peptide | B | 19 | Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | TAFQEPPPKPSRPKYRPPP |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2021-08-31 Deposition Author(s): Chill, J.H. , Gil-Henn, H. , Samson, A.O. , Sokolik, C.G.