Structure of the murine cortactin c-sh3 domain in complex with a pyk2 proline-rich ligand
PDB DOI: 10.2210/pdb7pll/pdb
Classification: CELL INVASION Organism(s): Mus Musculus , Synthetic Construct
Deposited: 2021-08-31 Deposition Author(s): Chill, J.H. , Gil-Henn, H. , Samson, A.O. , Sokolik, C.G.
Method: SOLUTION NMR Resolution: N.A.
Structure of the murine cortactin c-sh3 domain in complex with a pyk2 proline-rich ligand
Chill, J.H. , Gil-Henn, H. , Samson, A.O. , Sokolik, C.G.
Primary Citation of Related Structures: 7PLL
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Src substrate cortactin | A | 60 | Mus Musculus , Synthetic Construct | GHMGITAIALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGLFPANYVELRQ |
Pyk2-PRR2 peptide | B | 19 | Mus Musculus , Synthetic Construct | TAFQEPPPKPSRPKYRPPP |
Method: SOLUTION NMR
Deposited Date: 2021-08-31 Deposition Author(s): Chill, J.H. , Gil-Henn, H. , Samson, A.O. , Sokolik, C.G.