Solution structures of hiv-1 and sivmac p6 and their interaction with accessory proteins vpr and vpx in the presence of dpc micelles
PDB DOI: 10.2210/pdb7p3o/pdb
Classification: VIRAL PROTEIN Organism(s): Human Immunodeficiency Virus 1
Deposited: 2021-07-08 Deposition Author(s): Bouaziz, S. , Nonin-Lecomte, S. , Wang, X.
Solution structures of hiv-1 and sivmac p6 and their interaction with accessory proteins vpr and vpx in the presence of dpc micelles
Bouaziz, S. , Nonin-Lecomte, S. , Wang, X.
Primary Citation of Related Structures: 7P3O
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Gag protein | A | 52 | Human Immunodeficiency Virus 1 | LQSRPEPTAPPEESFRFGEETTTPSQKQEPIDKELYPLASLRSLFGSDPSSQ |
Method: SOLUTION NMR
Deposited Date: 2021-07-08 Deposition Author(s): Bouaziz, S. , Nonin-Lecomte, S. , Wang, X.