Ttslyd fkbp domain with m8a pseudo-wild-type s2 peptide
PDB DOI: 10.2210/pdb7oxg/pdb
Classification: ISOMERASE Organism(s): Thermus Thermophilus (Strain Atcc 27634 / Dsm 579 / Hb8) , Synthetic Construct
Deposited: 2021-06-22 Deposition Author(s): Lei, J. , Loew, C. , Pazicky, S.
Ttslyd fkbp domain with m8a pseudo-wild-type s2 peptide
Lei, J. , Loew, C. , Pazicky, S.
Primary Citation of Related Structures: 7OXG
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Peptidyl-prolyl cis-trans isomerase,Peptidyl-prolyl cis-trans isomerase | A | 110 | Thermus Thermophilus (Strain Atcc 27634 / Dsm 579 / Hb8) , Synthetic Construct | MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGATGHPGIIPPHATLDFQVEVVKVREATPEELLHGHAHPSGHHHHHH |
Peptidyl-prolyl cis-trans isomerase,Peptidyl-prolyl cis-trans isomerase | B | 110 | Thermus Thermophilus (Strain Atcc 27634 / Dsm 579 / Hb8) , Synthetic Construct | MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGATGHPGIIPPHATLDFQVEVVKVREATPEELLHGHAHPSGHHHHHH |
30S ribosomal protein S2 | C | 15 | Thermus Thermophilus (Strain Atcc 27634 / Dsm 579 / Hb8) , Synthetic Construct | TRYWNAKALPFAFGA |
30S ribosomal protein S2 | D | 15 | Thermus Thermophilus (Strain Atcc 27634 / Dsm 579 / Hb8) , Synthetic Construct | TRYWNAKALPFAFGA |
Method: X-RAY DIFFRACTION
Deposited Date: 2021-06-22 Deposition Author(s): Lei, J. , Loew, C. , Pazicky, S.