Nak s-di mutant with na+ and k+
PDB DOI: 10.2210/pdb7oph/pdb
Classification: TRANSPORT PROTEIN Organism(s): Bacillus Cereus (Strain Atcc 14579 / Dsm 31 / Jcm 2152 / Nbrc 15305 / Ncimb 9373 / Nrrl B-3711)
Deposited: 2021-05-31 Deposition Author(s): Minniberger, S. , Plested, A.J.R.
Nak s-di mutant with na+ and k+
Minniberger, S. , Plested, A.J.R.
Primary Citation of Related Structures: 7OPH
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Potassium channel protein | A | 96 | Bacillus Cereus (Strain Atcc 14579 / Dsm 31 / Jcm 2152 / Nbrc 15305 / Ncimb 9373 / Nrrl B-3711) | MWKDKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGSDISPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVPR |
Potassium channel protein | B | 96 | Bacillus Cereus (Strain Atcc 14579 / Dsm 31 / Jcm 2152 / Nbrc 15305 / Ncimb 9373 / Nrrl B-3711) | MWKDKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGSDISPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVPR |
Method: X-RAY DIFFRACTION
Deposited Date: 2021-05-31 Deposition Author(s): Minniberger, S. , Plested, A.J.R.