Nmr solution structure of snx9 sh3 - eeev nsp3 peptide complex
PDB DOI: 10.2210/pdb7oj9/pdb
Classification: ENDOCYTOSIS Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2021-05-14 Deposition Author(s): Permi, P. , Tossavainen, H.
Nmr solution structure of snx9 sh3 - eeev nsp3 peptide complex
Primary Citation of Related Structures: 7OJ9
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| EEEV nsP3 peptide | B | 23 | Homo Sapiens , Synthetic Construct | AERLIPRRPAPPVPVPARIPSPR |
| Sorting nexin-9 | A | 67 | Homo Sapiens , Synthetic Construct | GSHMATKARVMYDFAAEPGNNELTVNEGEIITITNPDVGGGWLEGRNIKGERGLVPTDYVEILPSDG |
Method: SOLUTION NMR
Deposited Date: 2021-05-14 Deposition Author(s): Permi, P. , Tossavainen, H.