Conserved hypothetical protein residues 311-335 from candidatus magnetomorum sp. hk-1 fused to gcn4 adaptors, mutant beta1/a, crystal form i
PDB DOI: 10.2210/pdb7oac/pdb
Classification: PROTEIN FIBRIL Organism(s): Candidatus Magnetomorum Sp. Hk-1 , Saccharomyces Cerevisiae (Strain Atcc 204508 / S288C)
Deposited: 2021-04-19 Deposition Author(s): Adlakha, J. , Albrecht, R. , Hartmann, M.D.
Conserved hypothetical protein residues 311-335 from candidatus magnetomorum sp. hk-1 fused to gcn4 adaptors, mutant beta1/a, crystal form i
Adlakha, J. , Albrecht, R. , Hartmann, M.D.
Primary Citation of Related Structures: 7OAC
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| General control transcription factor GCN4,conserved hypothetical protein residues 311-335 from Candidatus Magnetomorum sp. HK-1 fused to GCN4 adaptors, mutant beta1/A,General control transcription factor GCN4 | A | 86 | Candidatus Magnetomorum Sp. Hk-1 , Saccharomyces Cerevisiae (Strain Atcc 204508 / S288C) | GGGSGMKQIEMKIEEILSKIYHIENEIARIKKLINLKANKADAYTKDQAYTKTEINSQMKQIEWKIEEILSKIYHIENEIARIKKL |
| General control transcription factor GCN4,conserved hypothetical protein residues 311-335 from Candidatus Magnetomorum sp. HK-1 fused to GCN4 adaptors, mutant beta1/A,General control transcription factor GCN4 | B | 86 | Candidatus Magnetomorum Sp. Hk-1 , Saccharomyces Cerevisiae (Strain Atcc 204508 / S288C) | GGGSGMKQIEMKIEEILSKIYHIENEIARIKKLINLKANKADAYTKDQAYTKTEINSQMKQIEWKIEEILSKIYHIENEIARIKKL |
| General control transcription factor GCN4,conserved hypothetical protein residues 311-335 from Candidatus Magnetomorum sp. HK-1 fused to GCN4 adaptors, mutant beta1/A,General control transcription factor GCN4 | C | 86 | Candidatus Magnetomorum Sp. Hk-1 , Saccharomyces Cerevisiae (Strain Atcc 204508 / S288C) | GGGSGMKQIEMKIEEILSKIYHIENEIARIKKLINLKANKADAYTKDQAYTKTEINSQMKQIEWKIEEILSKIYHIENEIARIKKL |
Method: X-RAY DIFFRACTION
Deposited Date: 2021-04-19 Deposition Author(s): Adlakha, J. , Albrecht, R. , Hartmann, M.D.