Zbtb7a zinc finger domain bound to dna duplex containing ggaccc (oligo 23)
PDB DOI: 10.2210/pdb7n5w/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2021-06-06 Deposition Author(s): Cheng, X. , Horton, J.R. , Ren, R.
Zbtb7a zinc finger domain bound to dna duplex containing ggaccc (oligo 23)
Cheng, X. , Horton, J.R. , Ren, R.
Primary Citation of Related Structures: 7N5W
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Zinc finger and BTB domain-containing protein 7A | A | 133 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPLGSAFQKCPICEKVIQGAGKLPRHIRTHTGEKPYECNICKVRFTRQDKLKVHMRKHTGEKPYLCQQCGAAFAHNYDLKNHMRVHTGLRPYQCDSCCKTFVRSDHLHRHLKKDGCNGVPSRRGRKLERPHRD |
Method: X-RAY DIFFRACTION
Deposited Date: 2021-06-06 Deposition Author(s): Cheng, X. , Horton, J.R. , Ren, R.