Structural and biochemical insight into assembly of molecular motors involved in viral dna packaging
PDB DOI: 10.2210/pdb7lwr/pdb
Classification: VIRAL PROTEIN Organism(s): Enterobacteria Phage P21
Deposited: 2021-03-01 Deposition Author(s): Ortega, M.E.
Structural and biochemical insight into assembly of molecular motors involved in viral dna packaging
Primary Citation of Related Structures: 7LWR
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence | 
| Terminase, small subunit | A | 54 | Enterobacteria Phage P21 | MKVNKKRLAEIFNVDPRTIERWQSQGLPCASKGSKGIESVFDTAMAIQWYAQRE | 
| Terminase, small subunit | B | 54 | Enterobacteria Phage P21 | MKVNKKRLAEIFNVDPRTIERWQSQGLPCASKGSKGIESVFDTAMAIQWYAQRE | 
| Terminase, small subunit | C | 54 | Enterobacteria Phage P21 | MKVNKKRLAEIFNVDPRTIERWQSQGLPCASKGSKGIESVFDTAMAIQWYAQRE | 
| Terminase, small subunit | D | 54 | Enterobacteria Phage P21 | MKVNKKRLAEIFNVDPRTIERWQSQGLPCASKGSKGIESVFDTAMAIQWYAQRE | 
| Terminase, small subunit | E | 54 | Enterobacteria Phage P21 | MKVNKKRLAEIFNVDPRTIERWQSQGLPCASKGSKGIESVFDTAMAIQWYAQRE | 
| Terminase, small subunit | F | 54 | Enterobacteria Phage P21 | MKVNKKRLAEIFNVDPRTIERWQSQGLPCASKGSKGIESVFDTAMAIQWYAQRE | 
| Terminase, small subunit | G | 54 | Enterobacteria Phage P21 | MKVNKKRLAEIFNVDPRTIERWQSQGLPCASKGSKGIESVFDTAMAIQWYAQRE | 
| Terminase, small subunit | H | 54 | Enterobacteria Phage P21 | MKVNKKRLAEIFNVDPRTIERWQSQGLPCASKGSKGIESVFDTAMAIQWYAQRE | 
Method: X-RAY DIFFRACTION
Deposited Date: 2021-03-01 Deposition Author(s): Ortega, M.E.