7LUL
Structure of the mm2 erbin pdz variant in complex with a high-affinity peptide
PDB DOI: 10.2210/pdb7lul/pdb
Classification: SIGNALING PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2021-02-22 Deposition Author(s): Ernst, A. , Mclaughlin, M. , Sicheri, F. , Sidhu, S.S. , Singer, A.U. , Teyra, J.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.65 Å
Structure of the mm2 erbin pdz variant in complex with a high-affinity peptide
Ernst, A. , Mclaughlin, M. , Sicheri, F. , Sidhu, S.S. , Singer, A.U. , Teyra, J.
Primary Citation of Related Structures: 7LUL
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Erbin | A | 95 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SSMEIRVRVEKDPELGFSISGGVGGRGNPFRPDDDGIFVTRVQPEGPASKLLQPGDKIIQANGYSFINIRLEEAERLLKTFQNTVELIIVREVSS |
| peptide | B | 7 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | RWYERWV |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2021-02-22 Deposition Author(s): Ernst, A. , Mclaughlin, M. , Sicheri, F. , Sidhu, S.S. , Singer, A.U. , Teyra, J.