Structure of nedd4l ww3 domain
PDB DOI: 10.2210/pdb7lp4/pdb
Classification: LIGASE Organism(s): Homo Sapiens
Deposited: 2021-02-11 Deposition Author(s): Alam, S.L. , Alian, A. , Peterson, F.C. , Rheinemann, L. , Sundquist, W.I. , Thompson, T. , Volkman, B.F.
Structure of nedd4l ww3 domain
Alam, S.L. , Alian, A. , Peterson, F.C. , Rheinemann, L. , Sundquist, W.I. , Thompson, T. , Volkman, B.F.
Primary Citation of Related Structures: 7LP4
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| E3 ubiquitin-protein ligase NEDD4-like | A | 47 | Homo Sapiens | KVTQSFLPPGWEMRIAPNGRPFFIDHNTKTTTWEDPRLKFPVHMRSK |
Method: SOLUTION NMR
Deposited Date: 2021-02-11 Deposition Author(s): Alam, S.L. , Alian, A. , Peterson, F.C. , Rheinemann, L. , Sundquist, W.I. , Thompson, T. , Volkman, B.F.