High resolution nmr solution structure of a de novo designed minimal thioredoxin fold protein
PDB DOI: 10.2210/pdb7ldf/pdb
Classification: DE NOVO PROTEIN Organism(s): Synthetic Construct
Deposited: 2021-01-13 Deposition Author(s): Strauch, E.M. , Urbauer, J.L.
High resolution nmr solution structure of a de novo designed minimal thioredoxin fold protein
Primary Citation of Related Structures: 7LDF
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Minimal thioredoxin fold protein, ems_thioM_802 | A | 71 | Synthetic Construct | MDEVKVHVGDDQFEEVSREIKKAGWKVEVHKHPSNTSQVTVTKGNKQWTFKDPKQAVEFVQKSLEHHHHHH |
Method: SOLUTION NMR
Deposited Date: 2021-01-13 Deposition Author(s): Strauch, E.M. , Urbauer, J.L.