Crystal structure of the pdz domain of the serine peptidase htra from streptococcus agalactiae.
PDB DOI: 10.2210/pdb7l71/pdb
Classification: PROTEIN BINDING Organism(s): Streptococcus Agalactiae A909
Deposited: 2020-12-24 Deposition Author(s): Center For Structural Genomics Of Infectious Diseases (Csgid) , Kiryukhina, O. , Minasov, G. , Satchell, K.J.F. , Shuvalova, L.
Crystal structure of the pdz domain of the serine peptidase htra from streptococcus agalactiae.
Center For Structural Genomics Of Infectious Diseases (Csgid) , Kiryukhina, O. , Minasov, G. , Satchell, K.J.F. , Shuvalova, L.
Primary Citation of Related Structures: 7L71
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Serine protease | A | 114 | Streptococcus Agalactiae A909 | QVERPALGISMAGLSNLPSDVISKLKIPSNVTNGIVVASIQSGMPAQGKLKKYDVITKVDDKEVASPSDLQSLLYGHQVGDSITVTFYRGENKQTITIKLTKTSKDLAENLYFQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-12-24 Deposition Author(s): Center For Structural Genomics Of Infectious Diseases (Csgid) , Kiryukhina, O. , Minasov, G. , Satchell, K.J.F. , Shuvalova, L.