Nmr structure of a trna 2'-phosphotransferase from runella slithyformis
PDB DOI: 10.2210/pdb7kw8/pdb
Classification: TRANSFERASE Organism(s): Runella Slithyformis
Deposited: 2020-11-30 Deposition Author(s): Alphonse, S. , Banerjee, A. , Dantuluri, S. , Ghose, R. , Shuman, S.
Nmr structure of a trna 2'-phosphotransferase from runella slithyformis
Alphonse, S. , Banerjee, A. , Dantuluri, S. , Ghose, R. , Shuman, S.
Primary Citation of Related Structures: 7KW8
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| tRNA 2'-phosphotransferase | A | 178 | Runella Slithyformis | GSHMVKVSKFLSLVLRHNPALIGLDLDANGWAPVKELLAKMKAKGHGISMEELKHIVETNSKKRFAFSENFEKIRANQGHSVEVDLGYEKQVPPAVLFHGTAEKNFDLILKDGIKKMSRHHVHLSQDITTARKVGMRHGKPVVLSVDAKGMADGGFDFYLSNNGVWLIDFVPAEFIKV |
Method: SOLUTION NMR
Deposited Date: 2020-11-30 Deposition Author(s): Alphonse, S. , Banerjee, A. , Dantuluri, S. , Ghose, R. , Shuman, S.