High-throughput design and refinement of stable proteins using sequence-only models
PDB DOI: 10.2210/pdb7kuw/pdb
Classification: DE NOVO PROTEIN Organism(s): Synthetic Construct
Deposited: 2020-11-25 Deposition Author(s): Baker, D. , Bera, A.K. , Kang, A.S. , Stewart, L.
Method: X-RAY DIFFRACTION Resolution: 2.43 Å
High-throughput design and refinement of stable proteins using sequence-only models
Baker, D. , Bera, A.K. , Kang, A.S. , Stewart, L.
Primary Citation of Related Structures: 7KUW
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Sequence-Based Designed Protein nmt_0994_guided_02 | A | 62 | Synthetic Construct | DEREIARKVASELQKFSEWVKKLKEVIKKASPEQQTKIAQWVAKLAGVRPEDVKKIIKAFND |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-11-25 Deposition Author(s): Baker, D. , Bera, A.K. , Kang, A.S. , Stewart, L.