The internal aldimine form of the wild-type salmonella typhimurium tryptophan synthase with sodium ion at the metal coordination site, two molecules of f6f inhibitor at the enzyme alpha-site and another f6f molecule at the enzyme beta-site at 1.40 angstrom resolution
PDB DOI: 10.2210/pdb7ku9/pdb
Classification: LYASE/LYASE INHIBITOR Organism(s): Salmonella Typhimurium (Strain Lt2 / Sgsc1412 / Atcc 700720)
Deposited: 2020-11-24 Deposition Author(s): Dunn, M.F. , Hilario, E. , Mueller, L.J.
The internal aldimine form of the wild-type salmonella typhimurium tryptophan synthase with sodium ion at the metal coordination site, two molecules of f6f inhibitor at the enzyme alpha-site and another f6f molecule at the enzyme beta-site at 1.40 angstrom resolution
Dunn, M.F. , Hilario, E. , Mueller, L.J.
Primary Citation of Related Structures: 7KU9
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Tryptophan synthase alpha chain | A | 268 | Salmonella Typhimurium (Strain Lt2 / Sgsc1412 / Atcc 700720) | MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENRGALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA |
| Tryptophan synthase beta chain | B | 397 | Salmonella Typhimurium (Strain Lt2 / Sgsc1412 / Atcc 700720) | MTTLLNPYFGEFGGMYVPQILMPALNQLEEAFVSAQKDPEFQAQFADLLKNYAGRPTALTKCQNITAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGAGQHGVASALASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGSYETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILDKEGRLPDAVIACVGGGSNAIGMFADFINDTSVGLIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMQTADGQIEESYSISAGLDFPSVGPQHAYLNSIGRADYVSITDDEALEAFKTLCRHEGIIPALESSHALAHALKMMREQPEKEQLLVVNLSGRGDKDIFTVHDILKARGEI |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-11-24 Deposition Author(s): Dunn, M.F. , Hilario, E. , Mueller, L.J.