The crystal structure of papain-like protease of sars cov-2, c111s mutant, in complex with plp_snyder494 inhibitor
PDB DOI: 10.2210/pdb7koj/pdb
Classification: HYDROLASE/HYDROLASE inhibitor Organism(s): Gammaretrovirus
Deposited: 2020-11-09 Deposition Author(s): Azizi, S.A. , Center For Structural Genomics Of Infectious Diseases (Csgid) , Dickinson, B.C. , Endres, M. , Joachimiak, A. , Jones, K. , Kathayat, R. , Lisnyak, V. , Maki, S. , Osipiuk, J. , Snyder, S.A. , Taylor, C. , Tesar, C. , Zhang, Y. , Zhou, Z.
Method: X-RAY DIFFRACTION Resolution: 2.02 Å
The crystal structure of papain-like protease of sars cov-2, c111s mutant, in complex with plp_snyder494 inhibitor
Azizi, S.A. , Center For Structural Genomics Of Infectious Diseases (Csgid) , Dickinson, B.C. , Endres, M. , Joachimiak, A. , Jones, K. , Kathayat, R. , Lisnyak, V. , Maki, S. , Osipiuk, J. , Snyder, S.A. , Taylor, C. , Tesar, C. , Zhang, Y. , Zhou, Z.
Primary Citation of Related Structures: 7KOJ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Papain-like protease | A | 318 | Gammaretrovirus | SNAEVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNSYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIK |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-11-09 Deposition Author(s): Azizi, S.A. , Center For Structural Genomics Of Infectious Diseases (Csgid) , Dickinson, B.C. , Endres, M. , Joachimiak, A. , Jones, K. , Kathayat, R. , Lisnyak, V. , Maki, S. , Osipiuk, J. , Snyder, S.A. , Taylor, C. , Tesar, C. , Zhang, Y. , Zhou, Z.