Solution nmr structure of cdhr3 extracellular domain ec1
PDB DOI: 10.2210/pdb7knv/pdb
Classification: CELL ADHESION Organism(s): Homo Sapiens
Deposited: 2020-11-06 Deposition Author(s): Frederick, R.O. , Lee, W. , Markley, J.L. , Palmenberg, A.C. , Tonelli, M. , Watters, K.E.
Solution nmr structure of cdhr3 extracellular domain ec1
Frederick, R.O. , Lee, W. , Markley, J.L. , Palmenberg, A.C. , Tonelli, M. , Watters, K.E.
Primary Citation of Related Structures: 7KNV
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cadherin-related family member 3 | A | 126 | Homo Sapiens | MASDYKDDDDKLHLILLPATGNVAENSPPGTSVHKFSVKLSASLSPVIPGFPQIVNSNPLTEAFRVNWLSGTYFEVVTTGMEQLDFETGPNIFDLQIYVKDEVGVTDLQVLTVQVTDVNEPPGGTK |
Method: SOLUTION NMR
Deposited Date: 2020-11-06 Deposition Author(s): Frederick, R.O. , Lee, W. , Markley, J.L. , Palmenberg, A.C. , Tonelli, M. , Watters, K.E.