C1b domain of protein kinase c in complex with phorbol ester and phosphatidylcholine
PDB DOI: 10.2210/pdb7knj/pdb
Classification: LIPID BINDING PROTEIN Organism(s): Rattus Norvegicus
Deposited: 2020-11-04 Deposition Author(s): Katti, S.S. , Krieger, I.
Method: X-RAY DIFFRACTION Resolution: 1.57 Å
C1b domain of protein kinase c in complex with phorbol ester and phosphatidylcholine
Primary Citation of Related Structures: 7KNJ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protein kinase C delta type | A | 53 | Rattus Norvegicus | MPHRFKVYNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCG |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-11-04 Deposition Author(s): Katti, S.S. , Krieger, I.