Muscovy duck circovirus rep domain complexed with a single-stranded dna 10-mer comprising the cleavage site and mn2+
PDB DOI: 10.2210/pdb7kii/pdb
Classification: REPLICATION/DNA Organism(s): Methylobacterium Extorquens , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2020-10-23 Deposition Author(s): Gordon, W.R. , Shi, K. , Tompkins, K.J.
Method: X-RAY DIFFRACTION Resolution: 1.3 Å
Muscovy duck circovirus rep domain complexed with a single-stranded dna 10-mer comprising the cleavage site and mn2+
Gordon, W.R. , Shi, K. , Tompkins, K.J.
Primary Citation of Related Structures: 7KII
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
ATP-dependent helicase Rep | A | 111 | Methylobacterium Extorquens , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MAKSGNYSYKRWVFTINNPTFEDYVHVLEFCTLDNCKFAIVGEEKGANGTPHLQGFLNLRSNARAAALEESLGGRAWLSRARGSDEDNEEFCAKESTYLRVGEPVSKGRSS |
Nucleic Acids / Hybrid | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
DNA (5'-D(*TP*AP*TP*TP*AP*TP*TP*AP*CP*C)-3') | c | 10 | NA | TATTATTACC |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-10-23 Deposition Author(s): Gordon, W.R. , Shi, K. , Tompkins, K.J.