Crystal structure of bacillus halodurans oapb in complex with its ole rna target (crystal form ii)
PDB DOI: 10.2210/pdb7k9e/pdb
Classification: RNA-BINDING PROTEIN/RNA Organism(s): Bacillus Halodurans (Strain Atcc Baa-125 / Dsm 18197 / Ferm 7344 / Jcm 9153 / C-125) , Synthetic Construct
Deposited: 2020-09-29 Deposition Author(s): Breaker, R.R. , Yang, Y.
Crystal structure of bacillus halodurans oapb in complex with its ole rna target (crystal form ii)
Primary Citation of Related Structures: 7K9E
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| OLE-associated protein B | A | 98 | Bacillus Halodurans (Strain Atcc Baa-125 / Dsm 18197 / Ferm 7344 / Jcm 9153 / C-125) , Synthetic Construct | GPSPEIGQIVKIVKGRDRDQFSVIIKRVDDRFVYIADGDKRKVDRAKRKNMNHLKLIDHISPEVRHSFEETGKVTNGKLRFALKKFLEEHADLLKEGE |
| OLE-associated protein B | C | 98 | Bacillus Halodurans (Strain Atcc Baa-125 / Dsm 18197 / Ferm 7344 / Jcm 9153 / C-125) , Synthetic Construct | GPSPEIGQIVKIVKGRDRDQFSVIIKRVDDRFVYIADGDKRKVDRAKRKNMNHLKLIDHISPEVRHSFEETGKVTNGKLRFALKKFLEEHADLLKEGE |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-09-29 Deposition Author(s): Breaker, R.R. , Yang, Y.