Cftr associated ligand (cal) pdz domain bound to peptidomimetic lycalaeb
PDB DOI: 10.2210/pdb7jzr/pdb
Classification: PEPTIDE BINDING PROTEIN Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2020-09-02 Deposition Author(s): Gill, N.P. , Madden, D.R.
Cftr associated ligand (cal) pdz domain bound to peptidomimetic lycalaeb
Primary Citation of Related Structures: 7JZR
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Golgi-associated PDZ and coiled-coil motif-containing protein | A | 87 | Homo Sapiens , Synthetic Construct | GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV |
| Golgi-associated PDZ and coiled-coil motif-containing protein | B | 87 | Homo Sapiens , Synthetic Construct | GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV |
| LyCALAEB peptide core | C | 10 | Homo Sapiens , Synthetic Construct | ANSRLPTSKI |
| LyCALAEB peptide core | D | 10 | Homo Sapiens , Synthetic Construct | ANSRLPTSKI |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-09-02 Deposition Author(s): Gill, N.P. , Madden, D.R.