7JQD
Crystal structure of pac1r in complex with peptide antagonist
PDB DOI: 10.2210/pdb7jqd/pdb
Classification: SIGNALING PROTEIN/ANTAGONIST Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2020-08-10 Deposition Author(s): Fang-Tsao, H. , Hu, E. , Piper, D.E.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.7 Å
Crystal structure of pac1r in complex with peptide antagonist
Fang-Tsao, H. , Hu, E. , Piper, D.E.
Primary Citation of Related Structures: 7JQD
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Pituitary adenylate cyclase-activating polypeptide type I receptor | A | 105 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSMAHSDGIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPELFRIFNPDQDMGVVSRNCTEDGWSEPFPHYFDACGFDEYESET |
| Peptide-43 | B | 39 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | CDATCQFRKAIDDCARQAYHSSVFKACMKQKKKEWKAGX |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2020-08-10 Deposition Author(s): Fang-Tsao, H. , Hu, E. , Piper, D.E.